PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054379.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MIKC_MADS
Protein Properties Length: 109aa    MW: 12699.8 Da    PI: 10.1126
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054379.50genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.12.1e-32959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  EcC054379.50  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                  79***********************************************96 PP

2K-box16.73e-0781109836
         K-box   8 sleeakaeslqqelakLkkeienLqreqR 36 
                   + + +++++++q++ kLk+++e Lqr+qR
  EcC054379.50  81 NCSINEMQNSYQDYLKLKARVEVLQRSQR 109
                   477899*********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.726161IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-42160IPR002100Transcription factor, MADS-box
CDDcd002651.12E-43278No hitNo description
SuperFamilySSF554552.35E-35281IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-34323IPR002100Transcription factor, MADS-box
PfamPF003194.7E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-342338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-343859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010215Biological Processcellulose microfibril organization
GO:0016049Biological Processcell growth
GO:0030244Biological Processcellulose biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0031225Cellular Componentanchored component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0005524Molecular FunctionATP binding
GO:0016757Molecular Functiontransferase activity, transferring glycosyl groups
GO:0016866Molecular Functionintramolecular transferase activity
GO:0046983Molecular Functionprotein dimerization activity
GO:0051499Molecular FunctionD-aminoacyl-tRNA deacylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SSMMKTIEKY QKCSYGSLET NCSINEMQNS YQDYLKLKAR VEVLQRSQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-20270168Myocyte-specific enhancer factor 2A
3mu6_C2e-20270168Myocyte-specific enhancer factor 2A
3mu6_B2e-20270168Myocyte-specific enhancer factor 2A
3mu6_A2e-20270168Myocyte-specific enhancer factor 2A
1egw_D2e-20270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-20270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-20270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-20270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S2e-20174173Myocyte-specific enhancer factor 2B
1tqe_R2e-20174173Myocyte-specific enhancer factor 2B
1tqe_Q2e-20174173Myocyte-specific enhancer factor 2B
1tqe_P2e-20174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289642.13e-74developmental protein SEPALLATA 1-like
SwissprotQ396854e-61CMB1_DIACA; MADS-box protein CMB1
TrEMBLO649353e-74O64935_EUCGR; MADS box protein
STRINGPGSC0003DMT4000633159e-63(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.32e-60MIKC_MADS family protein